Details
Product Name |
Recombinant Mesocricetus auratus Major prion protein(PRNP) |
Catalog Number |
SIPB651Ha02 |
Expression host |
E.coli |
Product Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Buffer |
Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0. The volume before lyophilization is 1000μl/vial. |
Storage |
Store at -20℃, for extended storage, conserve at -20℃ or -80℃ . |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
Relevance |
Its primary physiological function is unclear. May play a role in neuronal development and synaptic plasticity. May be required for neuronal myelin sheath maintenance. May promote myelin homeostasis through acting as an agonist for ADGRG6 receptor. May play a role in iron uptake and iron homeostasis. Soluble oligomers are toxic to cultured neuroblastoma cells and induce apoptosis (in vitro) (By similarity). Association with GPC1 (via its heparan sulfate chains) targets PRNP to lipid rafts. Also provides Cu2+ or ZN2+ for the ascorbate-mediated GPC1 deaminase degradation of its heparan sulfate side chains (By similarity). |
AA sequence |
KKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGTWGQPHGGGWGQPHGGGW GQPHGGGWGQPHGGGWGQGGGTHNQWNKPSKPKTNMKHMAGAAAAGAVV GGLGGYMLGSAMSRPMMHFGNDWEDRYYRENMNRYPNQVYYRPVDQYNNQ NNFVHDCVNITIKQHTVTTTTKGENFTETDIKIMERVVEQMCTTQYQKESQAYY DGRRS |
Partial purchase records (0)
Leave a message
Scan Wechat Qrcode
Scan Whatsapp Qrcode